SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002117 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002117
Domain Number 1 Region: 21-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.23e-89
Family Carbonic anhydrase 0.000000000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002117   Gene: ENSPTRG00000001249   Transcript: ENSPTRT00000002314
Sequence length 337
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:128418551:128425831:1 gene:ENSPTRG00000001249 transcript:ENSPTRT00000002314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSALLLEVIWILAADGGQHWMYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATVAELHIVHYDSDSYDSLSEAAEKPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPPQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISTEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Download sequence
Identical sequences H2PZW3
9598.ENSPTRP00000002117 ENSPTRP00000002117 ENSPTRP00000002117 XP_003817362.1.60992 XP_524862.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]