SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002219 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002219
Domain Number 1 Region: 45-231
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 7.83e-41
Family PaaI/YdiI-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002219   Gene: ENSPTRG00000001301   Transcript: ENSPTRT00000002417
Sequence length 240
Comment pep:known chromosome:CHIMP2.1.4:1:130071515:130111100:-1 gene:ENSPTRG00000001301 transcript:ENSPTRT00000002417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSCAARLRTLWALCRPPVGRRLPGSVPRPELRSFSSEEVILKDCSVPNPSWNKDLRLL
FDQFMKKCEDGSWKRLPSYKRTPTERIQDFKTRFLDPKLMKEEQMSQAQLFTRSFDDGLG
FEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDSTVGMCAMMAGGIVMTANL
NINYKRPIPLCSVVMINSQLDEVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT
Download sequence
Identical sequences H2Q000
XP_513806.2.37143 ENSPTRP00000002219 9598.ENSPTRP00000002219 ENSPTRP00000002219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]