SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002361 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000002361
Domain Number - Region: 645-689
Classification Level Classification E-value
Superfamily RING/U-box 0.00203
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number - Region: 309-379
Classification Level Classification E-value
Superfamily TrmE connector domain 0.0915
Family TrmE connector domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002361   Gene: ENSPTRG00000001403   Transcript: ENSPTRT00000002569
Sequence length 706
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:133290106:133307223:1 gene:ENSPTRG00000001403 transcript:ENSPTRT00000002569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKHHQNGTRGQRRKQPHTTVQRLLTWGLPVSCSRFLWRQPGEFPVTALLLGAGAGGLL
AIGLFQLLVNPMNIYEEQKMMFLYSLVGLGAMGWGTSPHIRCASLLLVPKMLGKEGRLFV
LGYALAAIYVGPVANLRHNLNNVIASLGCTVELQINNTRAAWRVSTAPLRAVFKDLLSSK
ELLRAETRNISATFEDLDAQVNSETGYTPEDAMDSGETAQGREARQAPASRLHLSTQKMY
ELKTKLRCSYVVNQAILSCRRWFDRKHEQCMKHIWVPLLTHLLCLPMKFKFFCGIAKVME
VWCRNRIPVEGNFGQTYDSLNQSIRGLDGEFSANIDFKEQKQAGVLGLNTSWERVSTEVR
DYVYRQEARLEWALGLLHVLLSCTFLLVLHASFSYMDSYNHDIRFDNIYISTYFCQIDDR
RKKLGKRTLLPLRKAEEKTVIFPCKPTIQASEMSNVVRELLETLPILLLLVVLCGLDWAL
YSIFDTIRHHSFLQYSFRSSHKLEVKVGGDSMLARLLRKTIGALNTSSETVMESNNMPCL
PQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLK
KRAAFTKLRRAAILRRARQQKAPRHPLADILHRGCPLLRRWLRRRCVVCQAPETPESYVC
RTLDCEAVYCWSCWDNMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Download sequence
Identical sequences H2Q064
ENSPTRP00000002361 ENSPTRP00000002361 XP_003308461.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]