SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003180 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003180
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000314
Family LEM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003180   Gene: ENSPTRG00000024090   Transcript: ENSPTRT00000003455
Sequence length 181
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:184238307:184279438:-1 gene:ENSPTRG00000024090 transcript:ENSPTRT00000003455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDG
AQDSDDSEELNIILQGNIILSTEKSKKLKKWPEASTTKPKAVDNYCLDYKPSKGRRWAAR
APSTRITYGTITKERDYCAEDQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLF
G
Download sequence
Identical sequences A0A2I3THQ6
9598.ENSPTRP00000003180 ENSPTRP00000003180 ENSPTRP00000003180 XP_001161560.1.37143 XP_016792669.1.37143 XP_016792674.1.37143 XP_016792679.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]