SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003520 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003520
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily Histone-fold 2.1e-48
Family Nucleosome core histones 0.00000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003520   Gene: ENSPTRG00000002077   Transcript: ENSPTRT00000003812
Sequence length 130
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:207611404:207611796:-1 gene:ENSPTRG00000002077 transcript:ENSPTRT00000003812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
Download sequence
Identical sequences A0A061I1K9 A0A096NCF6 A0A0D9SA36 A0A1S3AHA8 A0A1S3F5K2 A0A1U7Q479 A0A1U7U3C4 A0A212D270 A0A287BFK0 A0A2I3HRJ3 A0A2K5E3B8 A0A2K5L0F1 A0A2K5PEK6 A0A2K5XLP9 A0A2K6ATI8 A0A2K6EVD1 A0A2K6K2I5 A0A2K6NCK7 A0A2K6SFB7 A2AB79 A4IFU5 D2I4T5 F6ZFT8 F7BRG1 F7INI1 G3S4Z9 G8F2Z0 H0X045 H2N3G4 H2Q1A3 L8IQ83 L9L1T8 M3XAE0 M3Z4A4 Q4FZT6 Q7L7L0 Q8BFU2 S9Z0I4
ENSSARP00000004744 ENSECAP00000004238 ENSCJAP00000040591 ENSTSYP00000006608 ENSSARP00000004744 ENSP00000355656 ENSRNOP00000060549 ENSVPAP00000002106 ENSECAP00000004238 ENSTTRP00000006016 ENSCJAP00000040591 10090.ENSMUSP00000104445 10116.ENSRNOP00000060549 9544.ENSMMUP00000001933 9598.ENSPTRP00000003520 9600.ENSPPYP00000000135 9606.ENSP00000355656 9685.ENSFCAP00000000626 9796.ENSECAP00000004238 9823.ENSSSCP00000014884 9913.ENSBTAP00000047589 ENSEEUP00000012975 ENSMUSP00000104445 ENSPPYP00000000135 ENSOGAP00000008259 ENSMUSP00000104445 ENSTSYP00000006608 ENSPTRP00000003520 ENSTTRP00000006016 ENSPANP00000010499 ENSOGAP00000008259 gi|15617199|ref|NP_254280.1| ENSBTAP00000047589 ENSPTRP00000003520 ENSMICP00000011578 ENSMPUP00000018416 ENSAMEP00000020404 ENSFCAP00000000626 ENSVPAP00000002106 ENSEEUP00000012975 NP_001091566.1.59421 NP_001091566.1.76553 NP_001252555.1.72884 NP_068612.2.100692 NP_068612.2.4139 NP_254280.1.87134 NP_254280.1.92137 NP_835736.1.92730 XP_002809381.1.23681 XP_003275195.1.23891 XP_003803252.1.62490 XP_003804826.1.60992 XP_003935360.1.74449 XP_004028598.1.27298 XP_004284073.1.21590 XP_004330559.1.83887 XP_004407125.1.74151 XP_004420548.1.5094 XP_004611557.1.94378 XP_004657495.1.11716 XP_004695451.1.23501 XP_004874790.1.39548 XP_005067769.1.91757 XP_005350048.1.66349 XP_005541140.1.63531 XP_005599707.1.31192 XP_005893955.1.15283 XP_005972392.1.78601 XP_006147053.1.99106 XP_006173189.1.101512 XP_006739042.1.47382 XP_006893969.1.29581 XP_006927522.1.62641 XP_007093504.1.5354 XP_007117398.1.24612 XP_007169970.1.59432 XP_007456563.1.90284 XP_007535145.1.11023 XP_007986331.1.81039 XP_008059797.1.4292 XP_008825244.1.79516 XP_008983924.1.60252 XP_010367159.1.97406 XP_010610323.1.5607 XP_010829009.1.44457 XP_010952173.1.22495 XP_010984397.1.51371 XP_011215264.1.58354 XP_011770748.1.29376 XP_011821084.1.47321 XP_011941604.1.92194 XP_012328151.1.9421 XP_012497176.1.63892 XP_012634027.1.48125 XP_012871112.1.60039 XP_012905527.1.14098 XP_014682196.1.49734 XP_014944517.1.54773 XP_015107093.1.17985 XP_015354282.1.40921 XP_015845137.1.50099 XP_016796001.1.37143 XP_017387563.1.71028 XP_017739345.1.44346 XP_019292779.1.44245 XP_019585400.1.88060 XP_020041260.1.5219 XP_020750368.1.74333 XP_020939041.1.46622 XP_021067462.1.100879 XP_021498923.1.76796 XP_021543032.1.83697 ENSGGOP00000023153 ENSMMUP00000001933 ENSAMEP00000020404 ENSMPUP00000018416 ENSNLEP00000022214 ENSGGOP00000023153 ENSP00000355656 ENSBTAP00000047589 ENSMUSP00000104445 ENSPPYP00000000135 ENSRNOP00000060549 ENSFCAP00000023593 ENSP00000355656 ENSMMUP00000001933 ENSNLEP00000022214 ENSMICP00000011578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]