SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003857 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003857
Domain Number 1 Region: 838-920
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.3e-18
Family PHD domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000003857
Domain Number - Region: 14-73
Classification Level Classification E-value
Superfamily Histone-fold 0.00848
Family Archaeal histone 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003857   Gene: ENSPTRG00000002278   Transcript: ENSPTRT00000004178
Sequence length 931
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:7907345:8103070:1 gene:ENSPTRG00000002278 transcript:ENSPTRT00000004178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTD
PILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEER
KEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRP
LDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLA
PPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIR
SPKTISKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVK
QIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIF
TSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
TPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQR
DREREKDKNKDKSKEKDKVKEKEKDKEAGRETKYPWKEFLKEEEADPYKFKIKEFEDVDP
KVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKE
LALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKPKEKEKKKDKKEKKKKKEKEKEKEK
KEKEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVV
PAPEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPLPLPLLAQAAAGPALLPSPGPAASGA
SAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIM
TAPPEEMQWFCPKCANKKKDKKHKKRKHRAH
Download sequence
Identical sequences H2Q1L6
XP_001157768.2.37143 9598.ENSPTRP00000003857 ENSPTRP00000003857 ENSPTRP00000003857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]