SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003959 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003959
Domain Number 1 Region: 350-490
Classification Level Classification E-value
Superfamily C-type lectin-like 8.59e-41
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 2 Region: 931-1083
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-39
Family C-type lectin domain 0.00049
Further Details:      
 
Domain Number 3 Region: 645-779
Classification Level Classification E-value
Superfamily C-type lectin-like 3.95e-38
Family C-type lectin domain 0.000000106
Further Details:      
 
Domain Number 4 Region: 789-925
Classification Level Classification E-value
Superfamily C-type lectin-like 1.19e-37
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 5 Region: 1221-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-35
Family C-type lectin domain 0.00018
Further Details:      
 
Domain Number 6 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.76e-35
Family Cysteine rich domain 0.000000804
Further Details:      
 
Domain Number 7 Region: 500-638
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 230-345
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-30
Family C-type lectin domain 0.00078
Further Details:      
 
Domain Number 9 Region: 1092-1218
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-28
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-20
Family Fibronectin type II module 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003959   Gene: ENSPTRG00000002336   Transcript: ENSPTRT00000004291
Sequence length 1456
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:18269163:18372348:1 gene:ENSPTRG00000002336 transcript:ENSPTRT00000004291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLLVFASVIPGAVLLLDTRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDNLCSRGYEAMYTLLGNANGATCAFPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYDTDKLFGYCPLKFEGSESLWNKDPLTSISYQINSKSALTW
HQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRY
LNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPT
HCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLASIHTIEEFDFIISQLGYEPND
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRGCEW
PLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLT
TIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKAGC
VAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCF
KLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQ
KGQTPKPEPTPAPQDNPPVTEDGWVTYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQS
ESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCV
TMYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTTPSVPSGCKEGWNFYSNKCFKIF
GFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFSAWTGLNDVNSEHTF
LWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQ
TRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNA
FAWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGYWK
TAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQAS
LECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGTWLWINNSPISFVNW
NTGDPSGERNDCVALHASSGFWSNIHCSSYKGYICKRPKIIDAKPTHELLTTKADTRKMD
PSKPSSNVAGVVIIVILLILTGAGLAAYFFYKKRRVHLPQEGAFENTLYFNSQSSPGTSD
MKDLVGNIEQNEHSVI
Download sequence
Identical sequences H2Q1P6
9598.ENSPTRP00000003959 ENSPTRP00000003959 ENSPTRP00000003959 XP_507681.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]