SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004474 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004474
Domain Number 1 Region: 179-368
Classification Level Classification E-value
Superfamily Macro domain-like 1.59e-46
Family Macro domain 0.000000233
Further Details:      
 
Domain Number 2 Region: 13-117
Classification Level Classification E-value
Superfamily Histone-fold 6.46e-38
Family Nucleosome core histones 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004474   Gene: ENSPTRG00000002581   Transcript: ENSPTRT00000004853
Sequence length 372
Comment pep:known chromosome:CHIMP2.1.4:10:68551525:68611620:1 gene:ENSPTRG00000002581 transcript:ENSPTRT00000004853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEI
LELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGT
KGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPG
DGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKE
FLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSA
AEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIG
IYVQEMAKLDAK
Download sequence
Identical sequences A0A024QZP6 A0A2K5C2B4 A0A2K5RYF7 A0A2K6TIF1 G3QT16 H2NAP0 H2Q209 L5M283 L8I4H3 Q9P0M6 S9X5L8 W5P731
ENSP00000362352 gi|8923920|ref|NP_061119.1| ENSP00000362352 ENSP00000362352 ENSPPYP00000002759 ENSPTRP00000004474 ENSGGOP00000005821 ENSGGOP00000005821 9598.ENSPTRP00000004474 9600.ENSPPYP00000002759 9606.ENSP00000362352 399878 ENSPPYP00000002759 NP_061119.1.87134 NP_061119.1.92137 XP_001170543.2.37143 XP_002820910.1.23681 XP_003928691.1.74449 XP_004021476.1.66739 XP_004049579.1.27298 XP_004280836.1.21590 XP_004324997.1.83887 XP_004680871.1.23501 XP_005904291.1.15283 XP_006078146.1.26621 XP_006181229.1.101512 XP_006760992.1.95426 XP_007103462.1.24612 XP_008967193.1.60992 XP_010949957.1.22495 XP_010991084.1.51371 XP_011980933.1.54773 XP_015356030.1.40921 XP_017404376.1.71028 XP_017897998.1.57651 XP_020733058.1.74333 XP_020733059.1.74333 XP_021532021.1.9421 ENSPTRP00000004474 ENSOARP00000006235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]