SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004712 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004712
Domain Number 1 Region: 369-479,592-738
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.41e-56
Family Phosphate binding protein-like 0.00000855
Further Details:      
 
Domain Number 2 Region: 18-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.46e-25
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004712   Gene: ENSPTRG00000002700   Transcript: ENSPTRT00000005098
Sequence length 940
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:85020461:85807047:-1 gene:ENSPTRG00000002700 transcript:ENSPTRT00000005098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKI
TYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNP
GGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYAVETNLA
SKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQ
EGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTI
KKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERP
MGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPD
GRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPE
EKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAI
WIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQ
DLSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGI
RKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRIL
ELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAIGLLLACLVA
ALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLA
PTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHR
SPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences 9598.ENSPTRP00000004712 ENSPTRP00000004712 ENSPTRP00000004712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]