SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005209 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005209
Domain Number 1 Region: 297-555
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-75
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 174-281
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000367
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005209   Gene: ENSPTRG00000002950   Transcript: ENSPTRT00000005631
Sequence length 560
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:112952630:112989223:1 gene:ENSPTRG00000002950 transcript:ENSPTRT00000005631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARMSDLHVLLLMALVGKTAYGFSLMSLLESLDPDWTPDQYDYSYEDYNEEENTSSTLT
HAENPDWYYTDDQTDPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPHYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS
CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTVSMPQGHFCGGALIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTEAGKGSRQLLDAKVKLIANTLCNSR
QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY
TQVTKFLNWIKATIKSESGF
Download sequence
Identical sequences H2Q2L0
XP_003825644.1.60992 XP_508042.2.37143 9598.ENSPTRP00000005209 ENSPTRP00000005209 ENSPTRP00000005209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]