SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006071 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006071
Domain Number 1 Region: 194-300
Classification Level Classification E-value
Superfamily Histone-fold 7.68e-26
Family Nucleosome core histones 0.019
Further Details:      
 
Domain Number 2 Region: 497-671
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-25
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 837-943
Classification Level Classification E-value
Superfamily POZ domain 1.28e-22
Family BTB/POZ domain 0.004
Further Details:      
 
Domain Number 4 Region: 120-186
Classification Level Classification E-value
Superfamily Histone-fold 0.000000156
Family Nucleosome core histones 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006071   Gene: ENSPTRG00000003495   Transcript: ENSPTRT00000006584
Sequence length 1025
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:34131443:34341892:-1 gene:ENSPTRG00000003495 transcript:ENSPTRT00000006584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTYSSTLKTLEDLTLDSGYGAGDSCRSLSLSSSKSNSQALNSSAQQHRGAAWWCYSGS
MNSRHNSWDTVNTVLPEDPEVADLFSRCPRLPELEEFPWTEGDVARVLRKGAGGRRLPQF
SAEAVRRLAGLLRRALIRVAREAQRLSVLHAKCTRFEVQSAVRLVHSWALAESCALAAVK
ALSLYSMSAGDGLRRGKSARCGLTFSVGRFFRWMVDTRISVRIHEYAAISLTACMENLVE
EIRARVMASQSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEHLICGKNANGVLSLP
AYFSPYNGGSLGHDERADAYAQLELRTLEQSLLATCVGSISELSDLVSRAMHHMQGRHPL
CPGASPARQARQPPQPITWSPDALHTLYYFLRCPQMESMENPNLDPPRMTLNNERPFMLL
PPLMEWMRVAITYAEHRRSLTVDSGDIRQAARLLLPGLDCEPRQLKPEHCFSSFRRLDAR
AATEKFNQDLGFRMLNCGRTDLINQAIEALGPDGVNTMDDQGMTPLMYACAAGDEAMVQM
LIDAGANLDIQVPSNSPRHPSIHPDSRHWTSLTFAVLHGHISVVQLLLDAGAHVEGSAVN
GGEDSYAETPLQLASAAGNYELVSLLLSRGADPLLSMLEAHGMGSSLHEDMNCFSHSAAH
GHRNVLRKLLTQPQQAKADVLSLEEILAEGVEESDASSQGSGSEGPVRLSRTRTKALQEA
MYYSAEHGYVDITMELRALGVPWKLHIWIESLRTSFSQSRYSVVQSLLRDFSSIKEEEYN
EELVTEGLQLMFDILKTSKNDSVIQQLAAIFTHCYGSSPIPSIPKIRKTLPARLDPHFLN
NKEMSDVTFLVEGKLFYAHKVLLVTASNRFKTLMTNKSEQDGDSSKTIEICDMKYHIFQM
MMQYLYYGGTESMEIPTADILELLSAASLFQLDALQRHCEILCSQTLSVESAVNTYKYAK
IHNAPELALFCEGFFLKHMKALLEQDAFRQLIYGRSSKVQGLDPLQDLQNTLAERVHSVY
ITSRV
Download sequence
Identical sequences ENSPTRP00000006071 ENSPTRP00000006071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]