SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006507 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006507
Domain Number 1 Region: 9-74
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000451
Family TBP-associated factors, TAFs 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000006507
Domain Number - Region: 193-345
Classification Level Classification E-value
Superfamily ARM repeat 0.00197
Family MIF4G domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006507   Gene: ENSPTRG00000003787   Transcript: ENSPTRT00000007055
Sequence length 622
Comment pep:known chromosome:CHIMP2.1.4:11:60695393:60711804:1 gene:ENSPTRG00000003787 transcript:ENSPTRT00000007055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKR
RKLTVEDFNRALRWSSVEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPK
GCAETAVRVHVSYLDGKGNLAPQGSVPSAVSSLTDDLLKYYHQVTRAVLGDDPQLMKVAL
QDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFRNPHLCLGPYVRCLVG
SVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQHILLSLQKILADP
VRPLCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYG
AILVAVERLLKMKAQAAEPNRGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLP
LPPGGAGPEDPSLSVTLADIYRELYAFFGDSLATRFGTGQPAPTAPRPPGDKKEPAAAPD
SVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLPRVHRARGALRQQGPG
TGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPM
IGRTSRPARRWALSDYSLYLPL
Download sequence
Identical sequences K7CMX5
9598.ENSPTRP00000006507 ENSPTRP00000006507 ENSPTRP00000006507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]