SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007486 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007486
Domain Number 1 Region: 2-220
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.5e-77
Family Phosphate binding protein-like 0.00000305
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000007486
Domain Number - Region: 222-240
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0484
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007486   Gene: ENSPTRG00000004368   Transcript: ENSPTRT00000008109
Sequence length 240
Comment pep:known chromosome:CHIMP2.1.4:11:117018032:117025660:1 gene:ENSPTRG00000004368 transcript:ENSPTRT00000008109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVIRVGTRKSQLARIQTDSVVTTLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLF
TKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETL
PEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMG
WHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHL
Download sequence
Identical sequences ENSPTRP00000007486 ENSPTRP00000007486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]