SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007487 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007487
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Histone-fold 6.44e-48
Family Nucleosome core histones 0.00000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007487   Gene: ENSPTRG00000004369   Transcript: ENSPTRT00000008110
Sequence length 136
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:116866500:117027834:-1 gene:ENSPTRG00000004369 transcript:ENSPTRT00000008110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TXXXXGSSPSGGKRGT
Download sequence
Identical sequences ENSPTRP00000007487 ENSPTRP00000007487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]