SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007751 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007751
Domain Number 1 Region: 29-148
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-43
Family FKBP immunophilin/proline isomerase 0.000000586
Further Details:      
 
Domain Number 2 Region: 258-414
Classification Level Classification E-value
Superfamily TPR-like 6.64e-34
Family Tetratricopeptide repeat (TPR) 0.0000000848
Further Details:      
 
Domain Number 3 Region: 142-257
Classification Level Classification E-value
Superfamily FKBP-like 7.27e-28
Family FKBP immunophilin/proline isomerase 0.000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007751   Gene: ENSPTRG00000004529   Transcript: ENSPTRT00000008389
Sequence length 459
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:2874365:2885612:1 gene:ENSPTRG00000004529 transcript:ENSPTRT00000008389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEQTKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPP
KIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKD
QLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPN
AELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE
EENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA
Download sequence
Identical sequences ENSPTRP00000007751 ENSPTRP00000007751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]