SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008065 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008065
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily Histone-fold 4.34e-48
Family Nucleosome core histones 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008065   Gene: ENSPTRG00000040058   Transcript: ENSPTRT00000008728
Sequence length 130
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26463285:26463677:-1 gene:ENSPTRG00000040058 transcript:ENSPTRT00000008728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
Download sequence
Identical sequences A0A0D9SCL2 A0A1S3AGE3 A0A1S3GEN8 A0A2I3GNS3 A0A2K5BZA7 A0A2K5HAP6 A0A2K5KMT3 A0A2K5PFC5 A0A2K5XEX7 A0A2K6AU93 A0A2K6EHV1 A0A2K6NDX2 A0A2K6S682 F2Z4G5 F7CJP0 G3SHJ3 G3TZR7 G7MR32 G7P2M8 H0Y2B9 H2Q5I5 P20671 W5PHK5
ENSECAP00000003474 ENSECAP00000004240 ENSECAP00000005842 ENSMICP00000005486 ENSMICP00000008349 ENSLAFP00000018786 ENSLAFP00000020650 ENSLAFP00000021075 ENSLAFP00000021886 ENSNLEP00000022255 ENSOARP00000009922 ENSP00000341094 ENSMICP00000005486 ENSMICP00000008349 ENSGGOP00000027582 ENSSARP00000000974 ENSSARP00000001869 ENSSARP00000002693 ENSSARP00000009380 ENSSARP00000009390 ENSSARP00000010260 ENSSARP00000012107 ENSSARP00000012114 ENSSARP00000012182 ENSCHOP00000006438 ENSCHOP00000009053 gi|10800130|ref|NP_066409.1| ENSEEUP00000000315 ENSEEUP00000002604 ENSEEUP00000005604 ENSEEUP00000006816 9361.ENSDNOP00000000455 9606.ENSP00000341094 9796.ENSECAP00000003474 9796.ENSECAP00000004240 9796.ENSECAP00000005842 9913.ENSBTAP00000033283 ENSDNOP00000000455 ENSNLEP00000022255 ENSSARP00000000974 ENSSARP00000001869 ENSSARP00000002693 ENSSARP00000009380 ENSSARP00000009390 ENSSARP00000010260 ENSSARP00000012107 ENSSARP00000012114 ENSSARP00000012182 ENSCHOP00000006438 ENSCHOP00000009053 ENSDORP00000008225 ENSDORP00000008227 ENSDORP00000008234 ENSGGOP00000027582 ENSPCAP00000002405 ENSBTAP00000033283 ENSDORP00000008225 ENSDORP00000008227 ENSDORP00000008234 ENSTTRP00000012766 ENSETEP00000002931 ENSETEP00000010632 ENSETEP00000012413 ENSETEP00000012860 ENSETEP00000016413 ENSTBEP00000004825 ENSECAP00000003474 ENSECAP00000004240 ENSECAP00000005842 ENSETEP00000002931 ENSETEP00000010632 ENSETEP00000012413 ENSETEP00000012860 ENSETEP00000016413 ENSTTRP00000012766 ENSOGAP00000007165 ENSOGAP00000022512 ENSPCAP00000002405 ENSEEUP00000000315 ENSEEUP00000002604 ENSEEUP00000005604 ENSEEUP00000006816 ENSBTAP00000033283 ENSPTRP00000008065 ENSP00000341094 ENSPANP00000007930 ENSPTRP00000008065 ENSOGAP00000007165 ENSOGAP00000022512 ENSMEUP00000000620 ENSLAFP00000018786 ENSLAFP00000020650 ENSLAFP00000021075 ENSLAFP00000021886 ENSTBEP00000004825 ENSP00000341094 NP_001180722.1.72884 NP_066409.1.87134 NP_066409.1.92137 XP_001505084.1.31192 XP_002746185.1.60252 XP_003416470.1.64505 XP_003421150.1.64505 XP_003421190.1.64505 XP_003583943.1.59421 XP_003587761.1.76553 XP_003767376.1.9362 XP_003788838.1.62490 XP_003804480.1.60992 XP_003950795.1.37143 XP_004019093.1.66739 XP_004043448.1.27298 XP_004088811.1.23891 XP_004286154.1.21590 XP_004317748.1.83887 XP_004384065.1.4749 XP_004384066.1.4749 XP_004387124.1.4749 XP_004387127.1.4749 XP_004463557.1.11602 XP_004621952.1.94378 XP_004621995.1.94378 XP_004621997.1.94378 XP_004622000.1.94378 XP_004712544.1.18182 XP_005553866.1.63531 XP_005603679.1.31192 XP_006872836.1.41390 XP_006872849.1.41390 XP_006872868.1.41390 XP_006888680.1.29581 XP_007105891.1.24612 XP_007128666.1.24612 XP_007449309.1.90284 XP_007534625.1.11023 XP_007534646.1.11023 XP_007534649.1.11023 XP_007534651.1.11023 XP_007948040.1.48129 XP_007948047.1.48129 XP_007955089.1.48129 XP_007971659.1.81039 XP_008145271.1.99482 XP_008539399.1.77740 XP_009239777.1.23681 XP_010336291.1.74449 XP_010362873.1.97406 XP_011741097.1.29376 XP_011818248.1.43180 XP_011821821.1.47321 XP_011886954.1.92194 XP_012014271.1.54773 XP_012314001.1.9421 XP_012494091.1.63892 XP_012597516.1.48125 XP_012668242.1.62490 XP_012886712.1.60039 XP_012886714.1.60039 XP_013832499.1.57651 XP_014337073.1.15283 XP_014589727.1.31192 XP_014644180.1.5094 XP_014684667.1.49734 XP_014707025.1.49734 XP_014707048.1.49734 XP_017360670.1.71028 XP_017704643.1.44346 XP_019840853.1.53367 XP_020006753.1.5219 XP_020008959.1.5219 XP_020008964.1.5219 XP_020008985.1.5219 XP_020758602.1.74333 ENSMEUP00000000620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]