SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009141 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009141
Domain Number 1 Region: 433-922
Classification Level Classification E-value
Superfamily ALDH-like 9.69e-166
Family ALDH-like 0.00000000071
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 2.49e-49
Family Formyltransferase 0.0000000184
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 6.44e-26
Family Post formyltransferase domain 0.0000139
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000009141
Domain Number - Region: 346-418
Classification Level Classification E-value
Superfamily ACP-like 0.00378
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009141   Gene: ENSPTRG00000005382   Transcript: ENSPTRT00000009886
Sequence length 923
Comment pep:known chromosome:CHIMP2.1.4:12:105344109:105412215:-1 gene:ENSPTRG00000005382 transcript:ENSPTRT00000009886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEVELVVDYISKEVNEMMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD
IDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences H2Q6R9
XP_001160213.1.37143 9598.ENSPTRP00000009141 ENSPTRP00000009141 ENSPTRP00000009141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]