SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009520 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009520
Domain Number 1 Region: 285-349
Classification Level Classification E-value
Superfamily RILP dimerisation region 8.89e-20
Family RILP dimerisation region 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009520   Gene: ENSPTRG00000022983   Transcript: ENSPTRT00000010288
Sequence length 393
Comment pep:known chromosome:CHIMP2.1.4:12:124322942:124387739:-1 gene:ENSPTRG00000022983 transcript:ENSPTRT00000010288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSR
HHVAPELDELRLELDRLRMERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEEN
KQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNED
VEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKL
RERLQGEHSQNGEEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELK
SKVFLLQEELAYYKSEEMEEENRISQPPPIAHPRTSPQPESGIKRLFSFFSRDKKRLANT
QRNVHIQESFGQWANTHRDDGYTEQGQEALQHL
Download sequence
Identical sequences 9598.ENSPTRP00000009520 ENSPTRP00000009520 ENSPTRP00000009520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]