SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009763 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009763
Domain Number 1 Region: 158-239
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.31e-17
Family Translation initiation factor IF3, C-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 78-148
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.0000000405
Family Translation initiation factor IF3, N-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009763   Gene: ENSPTRG00000005732   Transcript: ENSPTRT00000010554
Sequence length 278
Comment pep:known_by_projection chromosome:CHIMP2.1.4:13:27009937:27016587:-1 gene:ENSPTRG00000005732 transcript:ENSPTRT00000010554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAED
TQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRN
TSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQ
QWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVL
RALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Download sequence
Identical sequences A0A024RDQ7 H2Q7C1
ENSPTRP00000009763 XP_003314138.1.37143 XP_009425049.1.37143 XP_009425050.1.37143 XP_009425051.1.37143 XP_009425053.1.37143 XP_016780583.1.37143 XP_016780584.1.37143 XP_016780585.1.37143 XP_016780586.1.37143 XP_016780587.1.37143 XP_016780588.1.37143 XP_016780589.1.37143 XP_016780590.1.37143 XP_016780591.1.37143 XP_016780592.1.37143 XP_016780593.1.37143 XP_016780594.1.37143 XP_509598.3.37143 ENSPTRP00000009763 9598.ENSPTRP00000009763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]