SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009771 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009771
Domain Number 1 Region: 62-140
Classification Level Classification E-value
Superfamily Homeodomain-like 2.52e-25
Family Homeodomain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009771   Gene: ENSPTRG00000005738   Transcript: ENSPTRT00000010562
Sequence length 207
Comment pep:known_by_projection chromosome:CHIMP2.1.4:13:27554926:27560872:-1 gene:ENSPTRG00000005738 transcript:ENSPTRT00000010562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQS
PGPSWPAAYGAPLREKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLS
ERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVS
SLQASVSGSVPGVLGPTGGVLNPTVTQ
Download sequence
Identical sequences ENSPTRP00000009771 ENSPTRP00000009771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]