SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009995 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009995
Domain Number 1 Region: 25-314
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.67e-81
Family Regulator of chromosome condensation RCC1 0.014
Further Details:      
 
Domain Number 2 Region: 355-465
Classification Level Classification E-value
Superfamily POZ domain 4.32e-25
Family BTB/POZ domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009995   Gene: ENSPTRG00000005875   Transcript: ENSPTRT00000010797
Sequence length 531
Comment pep:known chromosome:CHIMP2.1.4:13:49248879:49282076:-1 gene:ENSPTRG00000005875 transcript:ENSPTRT00000010797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQ
STLVPKKLEGLCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQ
VCTNLLIKQVVEVACGSHHSMALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHI
KRVVGIACGQTSSMAVLDNGEVYGWGYNGNGQLGLGNNGNQLTPVRVAALHSVCVNQIVC
GYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIMVEKERVVEIAACHSAHTSAA
KTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVSWRLLSVEHEDFLTVAESL
KKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPV
YRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAV
RYDAEDLEEFCFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASKCGAFKN
Download sequence
Identical sequences H2Q7K5 Q8NDN9
ENSPTRP00000009995 NP_060661.3.87134 NP_060661.3.92137 XP_001155108.1.37143 XP_003809865.1.60992 XP_005266498.1.92137 XP_008960354.1.60992 XP_008960355.1.60992 XP_008960356.1.60992 XP_009425228.1.37143 XP_009425229.1.37143 XP_009425230.1.37143 XP_011533435.1.92137 XP_011533436.1.92137 XP_016781218.1.37143 gi|57242759|ref|NP_060661.3| ENSPTRP00000009995 9598.ENSPTRP00000009995 9606.ENSP00000258646 ENSP00000258646 HR6023 ENSP00000258646 ENSP00000367552 ENSP00000258646 ENSP00000367552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]