SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010566 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010566
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.09e-70
Family Eukaryotic proteases 0.000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010566   Gene: ENSPTRG00000006225   Transcript: ENSPTRT00000011420
Sequence length 246
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:23453020:23456175:-1 gene:ENSPTRG00000006225 transcript:ENSPTRT00000011420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPFLLLLAFLLTSGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCCGILVRKDFVL
TAAHCQGSSINVTLGVHNITERERTQQLIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKW
TTAVRPLRLPSSKAQVKPGQVCSVAGWGYVSMGTLATTLQEVSLTVQKDWECERLFHGNY
SRATEICVGDPKKTQTSSKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIK
RTMKRL
Download sequence
Identical sequences H2Q840
XP_522811.2.37143 9598.ENSPTRP00000010566 ENSPTRP00000010566 ENSPTRP00000010566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]