SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010567 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010567
Domain Number 1 Region: 39-280
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-70
Family Eukaryotic proteases 0.00000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010567   Gene: ENSPTRG00000006226   Transcript: ENSPTRT00000011421
Sequence length 281
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:23477430:23480726:-1 gene:ENSPTRG00000006226 transcript:ENSPTRT00000011421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLSLLHLFPLPRAKREQGENNSSSNQGSLPEKMQPILLLLAFLLLPRADAGEIIGGHE
AKPHSRPYMAYLMIWDQKTLKRCGGFLIREDFVLTAAHCWGSSINVTLGAHNIKEQEPTQ
QFIPVKRPIPHPAYNPKNYSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQVCSVAG
WGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGP
LVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH
Download sequence
Identical sequences XP_509879.2.37143 ENSPTRP00000010567 ENSPTRP00000010567 9598.ENSPTRP00000010567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]