SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010961 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010961
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.22e-42
Family eIF-2-alpha, C-terminal domain 0.000000524
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.31e-33
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.43e-17
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010961   Gene: ENSPTRG00000006462   Transcript: ENSPTRT00000011836
Sequence length 315
Comment pep:known chromosome:CHIMP2.1.4:14:66498149:66524050:1 gene:ENSPTRG00000006462 transcript:ENSPTRT00000011836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Download sequence
Identical sequences A0A096NVP0 A0A0D9RLK1 A0A2K5HV46 A0A2K5P003 A0A2K6A4S2 A0A2K6C3E4 A0A2K6MUQ2 F7EFD7 G1QIP7 G3QGW6 G7PAK4 H2NLK1 H2Q8H4 P05198 Q53XC0
ENSPTRP00000010961 9544.ENSMMUP00000028218 9598.ENSPTRP00000010961 9600.ENSPPYP00000006729 9606.ENSP00000256383 ENSMMUP00000028218 ENSMMUP00000028218 ENSP00000256383 ENSP00000425299 NP_001244395.1.72884 NP_001270066.1.63531 NP_004085.1.87134 NP_004085.1.92137 XP_003824115.1.60992 XP_004055369.1.27298 XP_007985247.1.81039 XP_007985248.1.81039 XP_011724707.1.29376 XP_011805115.1.43180 XP_011805116.1.43180 XP_011849624.1.47321 XP_011849625.1.47321 XP_011909251.1.92194 XP_012359805.1.23891 XP_015308721.1.63531 XP_017734075.1.44346 XP_017734076.1.44346 XP_510016.1.37143 Hs4758256___KOG2916 gi|4758256|ref|NP_004085.1| ENSPPYP00000006729 ENSGGOP00000001580 ENSNLEP00000000790 ENSP00000256383 ENSPTRP00000010961 ENSNLEP00000000790 ENSPPYP00000006729 ENSGGOP00000001580 ENSP00000256383 ENSP00000425299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]