SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011216 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011216
Domain Number 1 Region: 319-376
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 7-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000288
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011216
Domain Number - Region: 279-324
Classification Level Classification E-value
Superfamily ARM repeat 0.00564
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011216   Gene: ENSPTRG00000006596   Transcript: ENSPTRT00000012110
Sequence length 376
Comment pep:known chromosome:CHIMP2.1.4:14:80540015:80581926:-1 gene:ENSPTRG00000006596 transcript:ENSPTRT00000012110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
PDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQ
SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITTTGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNL
NGRDYIFSKAIGDAEW
Download sequence
Identical sequences K7ALN4
9598.ENSPTRP00000011216 ENSPTRP00000011216 XP_016782009.1.37143 ENSPTRP00000011216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]