SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011221 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011221
Domain Number 1 Region: 359-592
Classification Level Classification E-value
Superfamily HCP-like 2.01e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 566-700
Classification Level Classification E-value
Superfamily HCP-like 9.02e-27
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 199-323
Classification Level Classification E-value
Superfamily HCP-like 6.1e-25
Family HCP-like 0.003
Further Details:      
 
Domain Number 4 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011221   Gene: ENSPTRG00000006599   Transcript: ENSPTRT00000012115
Sequence length 794
Comment pep:known chromosome:CHIMP2.1.4:14:80835271:80897906:-1 gene:ENSPTRG00000006599 transcript:ENSPTRT00000012115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
LDSEESELESSIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLPQNIQ
AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
TAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
EATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQY
IRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPAPRPPGPRPA
PPQQEGPPEQQPPQ
Download sequence
Identical sequences H2Q8Q7
ENSPTRP00000011221 XP_003808949.1.60992 XP_510102.3.37143 9598.ENSPTRP00000011221 ENSPTRP00000011221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]