SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011549 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011549
Domain Number 1 Region: 8-364
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 6.54e-97
Family Glutaminase/Asparaginase 0.0000000867
Further Details:      
 
Domain Number 2 Region: 402-559
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-31
Family Ankyrin repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011549   Gene: ENSPTRG00000006766   Transcript: ENSPTRT00000012477
Sequence length 573
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:103811809:103839640:1 gene:ENSPTRG00000006766 transcript:ENSPTRT00000012477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAVGPERRLLAVYTGGTIGMRSELGVLVPGTGLAAILRTLPMFHDEEHAQARGLSEDT
LVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVRVAQTIERHYEQYHGFVVIHGTDTMA
FAASMLSFMLENLQKTVILTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRTTKVDARRFAAFCSPNLLPLATVGADITINRELVRKVDGKAGLVVHSSMEQDVGL
LRLYPGIPAALVRAFLQPPLKGVVMETFGSGNGPTKPDLLQELRVAAERGLVIVNCTHCL
QGAVTTDYAAGMAMAGAGVISGFDMTSEAALAKLSYVLGQPGLSLDDRKELLTKDLRGEM
TPPSVEERRPSLQGNTLGRGVSWLLSLSGSQEADALRNALVPSLACAAAHAGDLEALQAL
MELGSDLGLVDFNGQTPLHAAAWGGHTEAVTMLLQRGVDVNTRDTDGFSPLLLAVRGRHP
GVIGLLREAGASLSTQELEEAGTELCRLAYRADLEGLQVWWQAGADLGQPGYDGHSALHV
AEAAGNLAVVAFLQSLEGAVGAQAPCPEVLPGV
Download sequence
Identical sequences H2Q8Z8
ENSPTRP00000011549 XP_510194.2.37143 ENSPTRP00000011549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]