SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011903 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011903
Domain Number 1 Region: 343-689
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.02e-90
Family YicI catalytic domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 693-775
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.02e-22
Family Putative glucosidase YicI, domain 3 0.009
Further Details:      
 
Domain Number 3 Region: 72-160,211-341
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000000198
Family YicI N-terminal domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011903   Gene: ENSPTRG00000006973   Transcript: ENSPTRT00000012858
Sequence length 914
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:39212308:39297465:1 gene:ENSPTRG00000006973 transcript:ENSPTRT00000012858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAVKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEET
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPKPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIKRSKGKERPFVLTRSFFAGSEKYGAVWTGDNTAEWSNLKISIP
MLLTLSITGICFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIP
IKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSSADQRGRYPSKCVVEKILVLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSTLSLEK
LSLNIATDWEVRII
Download sequence
Identical sequences ENSPTRP00000011903 9598.ENSPTRP00000011903 ENSPTRP00000011903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]