SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012096 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012096
Domain Number 1 Region: 71-116
Classification Level Classification E-value
Superfamily LysM domain 0.000000000942
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012096   Gene: ENSPTRG00000007078   Transcript: ENSPTRT00000013059
Sequence length 215
Comment pep:known chromosome:CHIMP2.1.4:15:48945332:48960992:-1 gene:ENSPTRG00000007078 transcript:ENSPTRT00000013059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRA
PLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
KPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFL
QRLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS
Download sequence
Identical sequences H2Q9F9 Q8IV50
ENSP00000267838 gi|23503313|ref|NP_699205.1| 9598.ENSPTRP00000012096 9606.ENSP00000267838 NP_699205.1.87134 NP_699205.1.92137 XP_523075.2.37143 ENSPTRP00000012096 ENSP00000267838 ENSPTRP00000012096 ENSP00000267838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]