SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012165 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012165
Domain Number 1 Region: 28-513
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-184
Family ALDH-like 0.0000000000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012165   Gene: ENSPTRG00000007113   Transcript: ENSPTRT00000013132
Sequence length 518
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:55295758:55408884:-1 gene:ENSPTRG00000007113 transcript:ENSPTRT00000013132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNP
ATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVL
ATMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILP
GYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences A0A2I2URL8 A0A2K5CD43 A0A2K6UQZ9 F1PGT3 F7CVL4 G3QXF4 H2Q9I2
ENSECAP00000012983 9598.ENSPTRP00000012165 9615.ENSCAFP00000024319 9796.ENSECAP00000012983 9986.ENSOCUP00000014561 ENSPTRP00000012165 NP_001274018.1.84170 XP_001172159.1.37143 XP_001500420.1.31192 XP_002717750.1.1745 XP_003827933.1.60992 XP_003929025.1.74449 XP_004056304.1.27298 XP_008520028.1.77740 XP_011281203.1.62641 XP_012298448.1.9421 XP_014926375.1.86478 XP_019297517.1.44245 XP_019587869.1.88060 XP_019587870.1.88060 ENSGGOP00000007495 ENSECAP00000012983 ENSGGOP00000007495 ENSOCUP00000014561 ENSPTRP00000012165 ENSCAFP00000024344 ENSCAFP00000024344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]