SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012486 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012486
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.14e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000179
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.03e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000117
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.13e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012486   Gene: ENSPTRG00000007298   Transcript: ENSPTRT00000013470
Sequence length 390
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:72900296:72909083:1 gene:ENSPTRG00000007298 transcript:ENSPTRT00000013470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPPQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGRRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARSVLEALQQHRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKS
KATQPSPEDRVEDPLPPSKAPSRTRRAKRDLPKRTATQWPEGTSLQQDPEAPTVPKKGRR
KGRQAASGHCRPRKVKADIPSLEPEGTSAS
Download sequence
Identical sequences H2Q9U0
XP_001144008.1.37143 ENSPTRP00000012486 ENSPTRP00000012486 9598.ENSPTRP00000012486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]