SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012657 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012657
Domain Number 1 Region: 483-825
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.19e-109
Family PDEase 0.0000012
Further Details:      
 
Domain Number 2 Region: 221-324
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000174
Family Heme-binding PAS domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000012657
Domain Number - Region: 94-160
Classification Level Classification E-value
Superfamily CheY-like 0.00023
Family CheY-related 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012657   Gene: ENSPTRG00000007408   Transcript: ENSPTRT00000013651
Sequence length 829
Comment pep:known chromosome:CHIMP2.1.4:15:82281851:82437613:1 gene:ENSPTRG00000007408 transcript:ENSPTRT00000013651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYA
NPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSL
DVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPIS
LDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRS
WLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQG
IIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRM
LIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQDLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRSLRPPPE
Download sequence
Identical sequences H2QA09
ENSPTRP00000012657 XP_001163046.1.37143 ENSPTRP00000012657 9598.ENSPTRP00000012657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]