SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012735 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012735
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily EF-hand 7.05e-31
Family Calmodulin-like 0.0000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012735   Gene: ENSPTRG00000007449   Transcript: ENSPTRT00000013738
Sequence length 191
Comment pep:known chromosome:CHIMP2.1.4:15:87579471:87583287:-1 gene:ENSPTRG00000007449 transcript:ENSPTRT00000013738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILS
LPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
Download sequence
Identical sequences A0A140VK09 G3QQ48 K6ZLP5 Q99828
ENSPTRP00000012735 gi|163644313|ref|NP_006375.2| ENSP00000333873 ENSGGOP00000004706 ENSGGOP00000004706 NP_006375.2.87134 NP_006375.2.92137 XP_003807774.1.60992 XP_004056809.1.27298 XP_510591.2.37143 ENSPTRP00000012735 9598.ENSPTRP00000012735 9606.ENSP00000333873 ENSP00000333873 ENSP00000333873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]