SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012824 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012824
Domain Number 1 Region: 25-508
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-184
Family ALDH-like 0.00000000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012824   Gene: ENSPTRG00000007508   Transcript: ENSPTRT00000013837
Sequence length 512
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:98414412:98451578:1 gene:ENSPTRG00000007508 transcript:ENSPTRT00000013837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP
Download sequence
Identical sequences H2QA58
ENSPTRP00000012824 XP_001142882.1.37143 XP_003828480.1.60992 ENSPTRP00000012824 9598.ENSPTRP00000012824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]