SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013031 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013031
Domain Number 1 Region: 97-230
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.2e-32
Family Endonuclease III 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013031   Gene: ENSPTRG00000007628   Transcript: ENSPTRT00000014065
Sequence length 234
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:2102674:2107261:-1 gene:ENSPTRG00000007628 transcript:ENSPTRT00000014065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSPQESGMTALSARMLTRSRSLGPGAGPGCRDPGSLRRREAATQARKSHSPVKRPRKAQ
RLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSS
APPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFW
RSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGI
Download sequence
Identical sequences ENSPTRP00000013031 ENSPTRP00000013031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]