SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013055 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013055
Domain Number 1 Region: 10-320
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.18e-59
Family Quinoprotein alcohol dehydrogenase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013055   Gene: ENSPTRG00000007637   Transcript: ENSPTRT00000014090
Sequence length 326
Comment pep:known chromosome:CHIMP2.1.4:16:2265675:2270285:1 gene:ENSPTRG00000007637 transcript:ENSPTRT00000014090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEITPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDP
DASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG
Download sequence
Identical sequences A0A2K5D6A4 H2NPT6 H2QAC7 U3BJH5
ENSNLEP00000011254 XP_003806264.1.60992 XP_008949578.1.60992 XP_009248609.1.23681 XP_009248610.1.23681 XP_012297202.1.9421 XP_016784135.1.37143 XP_016784136.1.37143 ENSPTRP00000013055 ENSPTRP00000013055 ENSPPYP00000007913 ENSPPYP00000007913 9598.ENSPTRP00000013055 9600.ENSPPYP00000007913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]