SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013185 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013185
Domain Number 1 Region: 32-259
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.37e-74
Family Eukaryotic type heme oxygenase 0.000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013185   Gene: ENSPTRG00000007720   Transcript: ENSPTRT00000014230
Sequence length 316
Comment pep:known chromosome:CHIMP2.1.4:16:4526661:4561670:1 gene:ENSPTRG00000007720 transcript:ENSPTRT00000014230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
GSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM
Download sequence
Identical sequences A0A2I3TPT8 P30519
gi|187761307|ref|NP_001120676.1| gi|187761309|ref|NP_001120677.1| gi|187761311|ref|NP_001120678.1| gi|8051608|ref|NP_002125.3| ENSP00000219700 ENSP00000381595 ENSP00000385100 ENSP00000391637 ENSP00000394103 ENSP00000459214 9598.ENSPTRP00000013185 9606.ENSP00000219700 ENSP00000219700 hss001000610.1 ENSPTRP00000013185 NP_001120676.1.87134 NP_001120676.1.92137 NP_001120677.1.87134 NP_001120677.1.92137 NP_001120678.1.87134 NP_001120678.1.92137 NP_001273197.1.87134 NP_001273197.1.92137 NP_001273198.1.87134 NP_001273198.1.92137 NP_001273199.1.87134 NP_001273199.1.92137 NP_002125.3.87134 NP_002125.3.92137 XP_001168788.1.37143 XP_001168813.3.37143 XP_001168835.1.37143 XP_001168861.1.37143 XP_003815166.1.60992 XP_003815168.1.60992 XP_003815169.1.60992 XP_008966250.1.60992 XP_008966251.1.60992 XP_008966252.1.60992 XP_009428496.1.37143 XP_009428497.1.37143 XP_009428498.1.37143 XP_009428500.1.37143 XP_016784817.1.37143 XP_016878685.1.92137 XP_016878686.1.92137 ENSP00000219700 ENSP00000381595 ENSP00000385100 ENSP00000391637 ENSP00000394103 ENSP00000459214 ENSP00000478785 ENSP00000481295 ENSP00000481811 ENSP00000484422 ENSP00000484423 ENSP00000484467 ENSPTRP00000013185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]