SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013669 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013669
Domain Number 1 Region: 22-157
Classification Level Classification E-value
Superfamily EF-hand 5.37e-33
Family Calmodulin-like 0.000000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013669   Gene: ENSPTRG00000007997   Transcript: ENSPTRT00000014760
Sequence length 158
Comment pep:known chromosome:CHIMP2.1.4:16:30508674:30511675:1 gene:ENSPTRG00000007997 transcript:ENSPTRT00000014760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICY
Download sequence
Identical sequences ENSPTRP00000013669 ENSPTRP00000013669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]