SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013860 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013860
Domain Number 1 Region: 407-605
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.09e-68
Family Hemopexin-like domain 0.00000000185
Further Details:      
 
Domain Number 2 Region: 38-163,336-391
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.08e-38
Family Matrix metalloproteases, catalytic domain 0.000000338
Further Details:      
 
Domain Number 3 Region: 282-338
Classification Level Classification E-value
Superfamily Kringle-like 1.83e-21
Family Fibronectin type II module 0.0000635
Further Details:      
 
Domain Number 4 Region: 222-279
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-21
Family Fibronectin type II module 0.0000526
Further Details:      
 
Domain Number 5 Region: 166-221
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013860   Gene: ENSPTRG00000008123   Transcript: ENSPTRT00000014967
Sequence length 605
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:54532717:54558752:1 gene:ENSPTRG00000008123 transcript:ENSPTRT00000014967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANY
NFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIM
INFGRWYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKF
PFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPF
RFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTF
LGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQ
DPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVF
DGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFF
AGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVK
KKMDPGFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKS
DWLGC
Download sequence
Identical sequences ENSPTRP00000013860 ENSPTRP00000013860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]