SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013891 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013891
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily Metallothionein 2.5e-23
Family Metallothionein 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013891   Gene: ENSPTRG00000023341   Transcript: ENSPTRT00000015003
Sequence length 61
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:55725337:55726646:1 gene:ENSPTRG00000023341 transcript:ENSPTRT00000015003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPNCSCTTGGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGSSEKCRCC
A
Download sequence
Identical sequences H2QB55
XP_001139997.1.37143 XP_003823819.1.60992 XP_016785364.1.37143 ENSPTRP00000013891 9598.ENSPTRP00000013891 ENSPTRP00000013891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]