SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014076 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014076
Domain Number 1 Region: 438-524
Classification Level Classification E-value
Superfamily Histone-fold 9.7e-18
Family Archaeal histone 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014076   Gene: ENSPTRG00000008246   Transcript: ENSPTRT00000015199
Sequence length 561
Comment pep:known chromosome:CHIMP2.1.4:16:67108942:67114643:-1 gene:ENSPTRG00000008246 transcript:ENSPTRT00000015199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDNPDSDSTPRTLLRRVLDTADPRTPRRPRSARAGARRALLETASSRRLSGQTRTIAR
GRSHGARSIGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPARQVVQP
SRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSMFQQGVDQGLSLSQEPQGNA
DASSLTRSLNLTFATPLQPQSVQRPGLARRPPARRAVDVGAFLRDLRDTSLAPPNIVLED
TQPFSQPMVGSPHVYHSLPCTPHTGAEDAEQAAGRKTQSSGPGLQKNSPGKPAQFLAGEA
EEGDAFALGFLSTSSGVSGEDEVEPLHGGVEEAEKKMEEEGVSMSEMEATGAQGPSRVEE
AEGHTEVTEAEGSQGTAEADGPGASSGDEDASGRAASPESASSTPESLQARRHHQFIEPA
PAPGAAVLSSEPAEPLLVRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKAL
EMVEKCLDKYFQHLCDDLEVFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLP
LEYRQLLIPCAYSGNSVFPAQ
Download sequence
Identical sequences K7C938
XP_009429245.1.37143 9598.ENSPTRP00000014076 ENSPTRP00000014076 ENSPTRP00000014076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]