SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014769 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014769
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 1.9e-29
Family BTB/POZ domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 365-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 406-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 326-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014769   Gene: ENSPTRG00000008656   Transcript: ENSPTRT00000015962
Sequence length 479
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:7077700:7082031:1 gene:ENSPTRG00000008656 transcript:ENSPTRT00000015962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACS
GFFYSIFRGRAGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQM
EHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQG
PPSPASPDPKACNWKKYKYIVLNSQASQAGSLVGERSSGQPCPQARLPSGDEASSSSSSS
SSSSEEGPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSEWARPLPGSEF
FSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSI
CGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTR
FRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP
Download sequence
Identical sequences H2QC19
ENSPTRP00000014769 9598.ENSPTRP00000014769 ENSPTRP00000014769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]