SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014772 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014772
Domain Number 1 Region: 111-252
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-41
Family C-type lectin domain 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014772   Gene: ENSPTRG00000008662   Transcript: ENSPTRT00000015965
Sequence length 262
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:7228172:7233099:-1 gene:ENSPTRG00000008662 transcript:ENSPTRT00000015965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIG
SQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEGS
ERACCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVN
TWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVC
QRPYRWVCETELDKASQEPPLL
Download sequence
Identical sequences 9598.ENSPTRP00000014772 ENSPTRP00000014772 ENSPTRP00000014772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]