SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015752 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000015752
Domain Number - Region: 50-96
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0432
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015752   Gene: ENSPTRG00000009260   Transcript: ENSPTRT00000017017
Sequence length 257
Comment pep:known chromosome:CHIMP2.1.4:17:13421005:13424790:1 gene:ENSPTRG00000009260 transcript:ENSPTRT00000017017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG
AAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGF
LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMI
QLFFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLL
GESVGIFGTAVILATDG
Download sequence
Identical sequences G2HGV0 G3QZ39 Q96IK0
9598.ENSPTRP00000015752 9606.ENSP00000206380 NP_001233374.1.37143 NP_115752.1.87134 NP_115752.1.92137 XP_003828234.1.60992 XP_005257794.1.92137 XP_009430280.1.37143 XP_011523648.1.92137 XP_011523649.1.92137 XP_011523651.1.92137 XP_011523653.1.92137 XP_018883806.1.27298 ENSP00000206380 ENSP00000468025 ENSGGOP00000008138 ENSPTRP00000015752 gi|14150201|ref|NP_115752.1| ENSPTRP00000015752 ENSP00000206380 ENSP00000206380 ENSP00000468025 ENSGGOP00000008138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]