SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016005 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016005
Domain Number 1 Region: 52-305
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.89e-77
Family Carbonic anhydrase 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016005   Gene: ENSPTRG00000009419   Transcript: ENSPTRT00000017288
Sequence length 334
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:50228983:50747689:-1 gene:ENSPTRG00000009419 transcript:ENSPTRT00000017288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIRSRSGCGFTEPDELCMVGVRENAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVN
SAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHL
VNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAK
SPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFIT
YDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNN
RCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Download sequence
Identical sequences Q68D28
ENSPTRP00000016005 ENSP00000340363 ENSPTRP00000016005 9598.ENSPTRP00000016005 ENSP00000340363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]