SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016378 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016378
Domain Number 1 Region: 35-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.62e-48
Family Ribosomal protein S7 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016378   Gene: ENSPTRG00000009639   Transcript: ENSPTRT00000017679
Sequence length 242
Comment pep:known chromosome:CHIMP2.1.4:17:74181541:74186251:1 gene:ENSPTRG00000009639 transcript:ENSPTRT00000017679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVKVSRGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTE
EEKYDRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKR
KQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRR
FLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYR
WW
Download sequence
Identical sequences H2QDV1
XP_003813354.1.60992 XP_523718.1.37143 9598.ENSPTRP00000016378 ENSPTRP00000016378 ENSPTRP00000016378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]