SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016660 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016660
Domain Number 1 Region: 2195-2471
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.72e-65
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.00000000011
Further Details:      
 
Domain Number 2 Region: 1-241
Classification Level Classification E-value
Superfamily Thiolase-like 2.51e-65
Family Thiolase-related 0.0022
Further Details:      
 
Domain Number 3 Region: 206-383
Classification Level Classification E-value
Superfamily Thiolase-like 7.2e-41
Family Thiolase-related 0.0019
Further Details:      
 
Domain Number 4 Region: 469-594,657-754
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.66e-40
Family FabD-like 0.0059
Further Details:      
 
Domain Number 5 Region: 1853-2042
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8e-34
Family Tyrosine-dependent oxidoreductases 0.00028
Further Details:      
 
Domain Number 6 Region: 1616-1773
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.05e-33
Family Alcohol dehydrogenase-like, C-terminal domain 0.00022
Further Details:      
 
Domain Number 7 Region: 1188-1376
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.95e-17
Family UbiE/COQ5-like 0.034
Further Details:      
 
Domain Number 8 Region: 1536-1651
Classification Level Classification E-value
Superfamily GroES-like 4.19e-16
Family Alcohol dehydrogenase-like, N-terminal domain 0.0058
Further Details:      
 
Domain Number 9 Region: 2094-2159
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000262
Family Acyl-carrier protein (ACP) 0.00017
Further Details:      
 
Domain Number 10 Region: 594-650
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000222
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016660   Gene: ENSPTRG00000009791   Transcript: ENSPTRT00000017980
Sequence length 2481
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:81562422:81581433:-1 gene:ENSPTRG00000009791 transcript:ENSPTRT00000017980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC
PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGGIQEQLICSVGDPQELKGITRALCATRQEPLLIG
STKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFHSPNPEIPALLDGRLQVVDQPLPV
RGGNVGINSFGFGGSNVHVILRPNTQPPPAPAPHATLPRLLRASGRTPEAVQKLLEQGLR
HSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGEHGGPEVQQVPAGERPLWFICSGMGTQW
RGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLSTDESTFDDIVHSFVSLTAIQIGL
IDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAVLAAYWRGQCIKEAHLPPGAMAAV
GLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFEFVEQLRKEGVFAKEVRTGGMAFH
SYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEDQWHSGLARTSSAEYNVNNLVSPV
LFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCTIIPLMKKDHRDNLEFFLAGIGRL
HLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSLAWDVPAAEDFPNGSGSPSAAVYN
IDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLARALGLGVEQLPVVFEDVVLHQAT
ILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQWDDPDPRLFDHPESPTPNPAEPL
FLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRLLWKDNWVSFVDTMLQMSILGSAK
HGLYLPTRVTAIHIDPATHRQKLYTLQDKAQVADVVVSRWLRVTVAGGVHISGLHTESAP
RRQQEQQVPILEKFCFTPHMEEGCLSERAALQEELQLCKGLAQALQTKVTQQGLKMVVPG
LDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQVLAQERPKLPEDPLLSGLLDSPA
LKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLLSPHPLLQLSYTATDRHPQALEAA
QAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVAALGDPASALSNMVAALREGGFLL
LHTLLRGHPLGDIVAFLTSAEPQYGQGILSQDAWESLFSRVSLRLVGLKKSFYGSTLFLC
RRPAPQDSPIFLPVDDTSFRWVESLKGILADEDSSRPVWLKAINCATSGVVGLVNCLRRE
PGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGDLVMNVYRDGAWGAFRHFLLEEDK
PEEPTAHAFVTTLTRGDLSSIRWVCSSLRHAQPTCPGAQLCTVYYASLNFRDIMLATGKL
SPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLE
EAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGVGQAAIAIALSLGCRVFTPVYLQA
RFPQLDSTSFANSRDTSLEQHVLWHTGGKGVDLVLNSLAEEKLQASVRCLATHGRFLEIG
KFDLSQNHPLGMAIFLKNVTFHGVLLDAFFNESSADWREVWALVQAGIRDGVVRPLKCTV
FHGAQVEEAFRYMAQGKHIGKVVVQVLAEEPEAVLKGAKPKLMSAISKTFCPAHKSYIIA
GGLGGFGLELAQWLIQRGVQKLVLTSRSGIRTGYQAKQVRRWRRQGVQVQVSTSNISSLE
GARGLIAEAAQLGPVGGVFNLAVVLRDALLENQTPEFFQDVCKPKYSGTLNLDRVTREAC
PELDYFVVFSSVSCGRGNAGQSNYGFANSAMERICEKRRHEGLPGLAVQWGAIGDVGILV
ETMSTNDTVVTGTLPQRMASCLEVLDLFLNQPHMVLSSFVLAEKAAAYRDRDSQRDLVEA
VAHILGIRDLAAVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQEL
SSKAGEANELACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPI
EGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYG
ACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAVCF
FVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAA
EQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGL
ESIVSIIHSSLAEPRVSVREG
Download sequence
Identical sequences ENSPTRP00000016660 ENSPTRP00000016660 9598.ENSPTRP00000016660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]