SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016827 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000016827
Domain Number - Region: 228-265
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00589
Family Apolipoprotein A-I 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016827   Gene: ENSPTRG00000009889   Transcript: ENSPTRT00000018164
Sequence length 272
Comment pep:known_by_projection chromosome:CHIMP2.1.4:18:2802516:2864235:1 gene:ENSPTRG00000009889 transcript:ENSPTRT00000018164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWNVPRTVSRLARRTCLEPHNAGLFGHCQNVKGPLLLYNAESKVVLVQGPQKQWLHLSA
AQCVAKERRPLDAHPPQPGVLRHKQGKQHVSFRRVFSSSATAQGTPEKKEEPDPLQDKSI
SLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILK
NSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETK
ELITEKMEETKDRLTEKLQETKEKVSFKKKVE
Download sequence
Identical sequences G1RDC7 G3QK48 H2QEA9 Q96ND0
ENSP00000323635 ENSP00000386115 ENSPTRP00000016827 NP_001092271.1.87134 NP_001092271.1.92137 NP_689565.2.87134 NP_689565.2.92137 XP_003276754.1.23891 XP_003276755.1.23891 XP_003276756.1.23891 XP_018869687.1.27298 GO.36892 ENSP00000323635 9598.ENSPTRP00000016827 9606.ENSP00000323635 ENSGGOP00000002816 ENSGGOP00000002816 ENSNLEP00000011226 ENSP00000323635 ENSP00000386115 ENSNLEP00000011226 gi|116268105|ref|NP_689565.2| gi|149408153|ref|NP_001092271.1| ENSPTRP00000016827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]