SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017223 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017223
Domain Number 1 Region: 44-155
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 2.49e-25
Family Ribosome-binding factor A, RbfA 0.000000673
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017223   Gene: ENSPTRG00000010137   Transcript: ENSPTRT00000018594
Sequence length 299
Comment pep:known chromosome:CHIMP2.1.4:18:76361823:76373757:1 gene:ENSPTRG00000010137 transcript:ENSPTRT00000018594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKFASKTKKKVWYESPSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKAL
TDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMR
HLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFRDPDAPQP
CGTTEPATSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKP
RLEQDSSLKSYLSGEEVEDDLDPVGAPEYECYAPDTEELEAERGGGRTEDGHSCGASRE
Download sequence
Identical sequences ENSPTRP00000017223 9598.ENSPTRP00000017223 ENSPTRP00000017223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]