SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017681 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017681
Domain Number 1 Region: 999-1138
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.8e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017681   Gene: ENSPTRG00000010394   Transcript: ENSPTRT00000019101
Sequence length 1144
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:7705185:7718296:1 gene:ENSPTRG00000010394 transcript:ENSPTRT00000019101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HVPPELWEPFYTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLETPPNPSALLALLAR
RGTVPALPERPVREADLRHQPILMGAHLAVIDALMAAFAFEWTKTLPGPLALTSLEHKLL
FWVDTTVRRLQEKTEQEAAQRASPAAPADGAAPAQPSCPTRWYWKLVPHAIAFCLKESGS
KPPMVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLLYVPPPLKVNLVVMLAEL
FMCFEVLKPDFVQVKDLPDGHAASPRGIEASPPQNNSGSSSPVFTFRHPLLSSGGPQSPL
RGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDVDVVMGDPVLLRSV
SSDSLGPPRPAPARTPTQPPPEPGDLPTIEEALQIIHSAEPRLLPDGAADGSFYLHSPEG
PSKPSLASPYLPEGTSKPLSDRPTKAPVYMPHPETPSKPSPCLVGEASKPPAPSEGSPKS
VASSPAATNSEVKMTSFAERKKQLVKAEAEAGAGSPTSTLAPPEALSSEMSELGARLEEK
RRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREASGEAEAEAEADSVPVPGGERPAGEG
QGEPTSRPKAVTFSPDLGPVPPEGLGEYNRAVSKLSAALSSLQRDMQRLTDQQQRLLAPP
EAPGSAPPPAAWVIPGPTTGPKAASPSPARRVPATRRSPGPGPSQSPRSPKHTRPVELRL
APLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEETPPEEPATRPGLIEIPLGSL
ADPAAEDEGDGSPAGAEDSLEEEASSEGEPRVGLGFFYKDEDKPEDEMAQKRASLLERQQ
RRAEEARRRKQWQEVEKEQRREEAARLAQEEAPGPAPLVSAVPMATPAPAARAPAEEEVG
PRKGDFTRQEYERRAQLKLMDDLDKVLRPRAAGSGGPGRGGRRATRPRSGCCDDSALARS
PARGLLAPSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSNKFII
HNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRL
AGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQGKKPTTPKKGG
GTPK
Download sequence
Identical sequences ENSPTRP00000017681 ENSPTRP00000017681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]